Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBIP Rabbit Polyclonal Antibody (Biotin)

MBIP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9NS73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MBIP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 (Retinal Dehydrogenase 1, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase Cytosolic, ALDC, ALDH1, PUMB1)
305490-01 50 µg

ALDH1A1 (Retinal Dehydrogenase 1, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase Cytosolic, ALDC, ALDH1, PUMB1)

Sign In for Pricing
View Details
ALDH1A1 (Retinal Dehydrogenase 1, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase Cytosolic, ALDC, ALDH1, PUMB1)
305490-02 100 µg

ALDH1A1 (Retinal Dehydrogenase 1, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase Cytosolic, ALDC, ALDH1, PUMB1)

Sign In for Pricing
View Details
Anti- Human Cell surface glycoprotein CD200 receptor 2 / CD200R1L
IT-300-170M1-01 0.1 mg

Anti- Human Cell surface glycoprotein CD200 receptor 2 / CD200R1L

Sign In for Pricing
View Details
Anti- Human Cell surface glycoprotein CD200 receptor 2 / CD200R1L
IT-300-170M1-02 0.5 mg

Anti- Human Cell surface glycoprotein CD200 receptor 2 / CD200R1L

Sign In for Pricing
View Details
Amy2a5 Recombinant Protein (Mouse)
RP115667 100 µg

Amy2a5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Enah qPCR Primer Pair
QM02386S 200 Tests

Mouse Enah qPCR Primer Pair

Sign In for Pricing
View Details