Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGST3 Rabbit Polyclonal Antibody (FITC)

MGST3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GST-III

UniProt

O14880

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MGST3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004519

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL8 Antibody
OAGA06715-100UL 100 µL

OSBPL8 Antibody

Sign In for Pricing
View Details
PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (Biotin)
249783-Biotin 100 µL

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (Biotin)

Sign In for Pricing
View Details
ACPP Antibody
CSB-PA001181GA01HU 100 µL

ACPP Antibody

Sign In for Pricing
View Details
XmaI Enzyme
abx071051-01 250 U

XmaI Enzyme

Sign In for Pricing
View Details
XmaI Enzyme
abx071051-02 500 U

XmaI Enzyme

Sign In for Pricing
View Details
BIRC3, NT (Baculoviral IAP Repeat-containing Protein 3, Apoptosis Inhibitor 2, API2, C-IAP2, IAP Homolog C, Inhibitor of Apoptosis Protein 1, IAP-1, hIAP-1, hIAP1, RING Finger Protein 49, TNFR2-TRAF-signaling Complex Protein 1, API2, IAP1, MIHC, RNF49) (Azide free) (HRP) discontinued
B2050-01H-HRP 200 µL

BIRC3, NT (Baculoviral IAP Repeat-containing Protein 3, Apoptosis Inhibitor 2, API2, C-IAP2, IAP Homolog C, Inhibitor of Apoptosis Protein 1, IAP-1, hIAP-1, hIAP1, RING Finger Protein 49, TNFR2-TRAF-signaling Complex Protein 1, API2, IAP1, MIHC, RNF49) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details