Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST5 Rabbit Polyclonal Antibody (HRP)

ST5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ST5, HTS1, p126

UniProt

P78524

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ST5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPKPKRTFEYEADKNPKSKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005409

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)
MBS1288180-01 0.02 mg (E-Coli)

Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)

Sign In for Pricing
View Details
Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)
MBS1288180-02 0.1 mg (E-Coli)

Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)

Sign In for Pricing
View Details
Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)
MBS1288180-03 1 mg (E-Coli)

Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)

Sign In for Pricing
View Details
Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)
MBS1288180-04 5x 1 mg (E-Coli)

Recombinant Saimiri boliviensis boliviensis Cathepsin S (CTSS)

Sign In for Pricing
View Details
MYH9, CT (MYH9, Myosin-9, Cellular myosin heavy chain, type A, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, Non-muscle myosin heavy chain A, Non-muscle myosin heavy chain IIa) (Biotin)
MBS6323299-01 0.2 mL

MYH9, CT (MYH9, Myosin-9, Cellular myosin heavy chain, type A, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, Non-muscle myosin heavy chain A, Non-muscle myosin heavy chain IIa) (Biotin)

Sign In for Pricing
View Details
MYH9, CT (MYH9, Myosin-9, Cellular myosin heavy chain, type A, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, Non-muscle myosin heavy chain A, Non-muscle myosin heavy chain IIa) (Biotin)
MBS6323299-02 5x 0.2 mL

MYH9, CT (MYH9, Myosin-9, Cellular myosin heavy chain, type A, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, Non-muscle myosin heavy chain A, Non-muscle myosin heavy chain IIa) (Biotin)

Sign In for Pricing
View Details