Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR83 Rabbit Polyclonal Antibody (HRP)

WDR83 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MORG1

UniProt

Q9BRX9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WDR83

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal PSCD1 Antibody (monoclonal) (M01), Clone: 1D6
AMM07363G 0.1mg

Monoclonal PSCD1 Antibody (monoclonal) (M01), Clone: 1D6

Sign In for Pricing
View Details
TNRC6A (trinucleotide Repeat Containing 6A, CAGH26, DKFZp666E117, FLJ22043, GW1, GW182, KIAA1460, MGC75384, TNRC6) (HRP)
MBS6181961-01 0.1 mL

TNRC6A (trinucleotide Repeat Containing 6A, CAGH26, DKFZp666E117, FLJ22043, GW1, GW182, KIAA1460, MGC75384, TNRC6) (HRP)

Sign In for Pricing
View Details
TNRC6A (trinucleotide Repeat Containing 6A, CAGH26, DKFZp666E117, FLJ22043, GW1, GW182, KIAA1460, MGC75384, TNRC6) (HRP)
MBS6181961-02 5x 0.1 mL

TNRC6A (trinucleotide Repeat Containing 6A, CAGH26, DKFZp666E117, FLJ22043, GW1, GW182, KIAA1460, MGC75384, TNRC6) (HRP)

Sign In for Pricing
View Details
B-Raf (Ab-753) Antibody
E11-8305B 100 µg

B-Raf (Ab-753) Antibody

Sign In for Pricing
View Details
Olfr1220 Lentiviral Activation Particles (m2)
sc-434996-LAC-2 200 µL

Olfr1220 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Recombinant Rhodopirellula baltica DNA ligase (ligA), partial
MBS1345305 Inquire

Recombinant Rhodopirellula baltica DNA ligase (ligA), partial

Sign In for Pricing
View Details