Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd6 Rabbit Polyclonal Antibody (HRP)

Acbd6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5RJK8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Acbd6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001011906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acat3 3'UTR GFP Stable Cell Line
TU151239 1.0 mL

Acat3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SLC44A2 Protein Vector (Mouse) (pPM-C-HA)
PV230964 500 ng

SLC44A2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PAK4/5/6 discontinued
345172-01 100 µL

PAK4/5/6 discontinued

Sign In for Pricing
View Details
PAK4/5/6 discontinued
345172-02 200 µL

PAK4/5/6 discontinued

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1301892-01 0.02 mg (E-Coli)

Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1301892-02 0.1 mg (E-Coli)

Recombinant Sodalis glossinidius DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details