Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD6 Rabbit Polyclonal Antibody (HRP)

ACBD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC2404

UniProt

Q9BR61

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACBD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse CD200 Flow Cytometry Monoclonal Clone OX90 APC 25ug
IRTAMSCD200OX90CAPC25UG 25 µg

Anti Mouse CD200 Flow Cytometry Monoclonal Clone OX90 APC 25ug

Sign In for Pricing
View Details
PheM Antibody
orb818098 2 mg

PheM Antibody

Sign In for Pricing
View Details
EIF2S1 (Eukaryotic Translation Initiation Factor 2, Subunit 1 alpha, eIF2 alpha, eIF-2-alpha, eIF-2A, eIF-2alpha, EIF2A, Eukaryotic Translation Initiation Factor 2 Subunit 1) (MaxLight 750)
MBS6232645-01 0.1 mL

EIF2S1 (Eukaryotic Translation Initiation Factor 2, Subunit 1 alpha, eIF2 alpha, eIF-2-alpha, eIF-2A, eIF-2alpha, EIF2A, Eukaryotic Translation Initiation Factor 2 Subunit 1) (MaxLight 750)

Sign In for Pricing
View Details
EIF2S1 (Eukaryotic Translation Initiation Factor 2, Subunit 1 alpha, eIF2 alpha, eIF-2-alpha, eIF-2A, eIF-2alpha, EIF2A, Eukaryotic Translation Initiation Factor 2 Subunit 1) (MaxLight 750)
MBS6232645-02 5x 0.1 mL

EIF2S1 (Eukaryotic Translation Initiation Factor 2, Subunit 1 alpha, eIF2 alpha, eIF-2-alpha, eIF-2A, eIF-2alpha, EIF2A, Eukaryotic Translation Initiation Factor 2 Subunit 1) (MaxLight 750)

Sign In for Pricing
View Details
Human METTL3 knockout cell line
ABC-KH17921 1 Vial

Human METTL3 knockout cell line

Sign In for Pricing
View Details
ID3 (Inhibitor of DNA Binding 3, HEIR-1, Dominant negative helix-loop-helix protein) discontinued
319886 100 µL

ID3 (Inhibitor of DNA Binding 3, HEIR-1, Dominant negative helix-loop-helix protein) discontinued

Sign In for Pricing
View Details