Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf64 Rabbit Polyclonal Antibody (HRP)

C9orf64 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC10999, RP11-575L7.5

UniProt

Q5T6V5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C9orf64

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_115683

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Noradrenalin (Norepinephrine) ELISA
RE59261 96 Determinations

Noradrenalin (Norepinephrine) ELISA

Sign In for Pricing
View Details
Lentiviral human HYLS1 sgRNA gene knockout kit - Lentiviral human HYLS1 sgRNA gene knockout kit (plasmid)
GTR15393866 1 Vial

Lentiviral human HYLS1 sgRNA gene knockout kit - Lentiviral human HYLS1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SCP2 Antibody - N-terminal region : Biotin (ARP56537_P050-Biotin)
ARP56537_P050-Biotin 100 µL

SCP2 Antibody - N-terminal region : Biotin (ARP56537_P050-Biotin)

Sign In for Pricing
View Details
Mouse Svop qPCR Primer Pair
QM36558S 200 Tests

Mouse Svop qPCR Primer Pair

Sign In for Pricing
View Details
RAP2B Blocking Peptide
orb706019-01 1 mg

RAP2B Blocking Peptide

Sign In for Pricing
View Details
RAP2B Blocking Peptide
orb706019-02 5 mg

RAP2B Blocking Peptide

Sign In for Pricing
View Details