Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD27 Rabbit Polyclonal Antibody (FITC)

ANKRD27 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

VARP, PP12899

UniProt

Q96NW4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ANKRD27

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115515

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMAD4 shRNA (UAS) - Lentiviral human SMAD4 shRNA (UAS, GFP) plasmid
GTR15121978 1 Vial

Lentiviral human SMAD4 shRNA (UAS) - Lentiviral human SMAD4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-RBM15 Antibody, Rabbit Polyclonal
MBS8119089-01 0.1 mL

Anti-RBM15 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RBM15 Antibody, Rabbit Polyclonal
MBS8119089-02 5x 0.1 mL

Anti-RBM15 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit
MBS285531-01 48 Tests

Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit

Sign In for Pricing
View Details
Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit
MBS285531-02 96 Tests

Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit

Sign In for Pricing
View Details
Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit
MBS285531-03 5x 96 Tests

Cat Interleukin-2 receptor subunit alpha (IL2RA) ELISA Kit

Sign In for Pricing
View Details