Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKK1 Rabbit Polyclonal Antibody (HRP)

CAMKK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAMKKA

UniProt

Q8N5S9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_757344

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MED13 sgRNA gene knockout kit - Lentiviral human MED13 sgRNA gene knockout kit (plasmid)
GTR15392030 1 Vial

Lentiviral human MED13 sgRNA gene knockout kit - Lentiviral human MED13 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
DiI Perchlorate (25 mg)
C0050 25 mg

DiI Perchlorate (25 mg)

Sign In for Pricing
View Details
ANKFY1 (B-6) Alexa Fluor® 680
sc-393353 AF680 200 µg/mL

ANKFY1 (B-6) Alexa Fluor® 680

Sign In for Pricing
View Details
pCMV-SPORT6-LYG1 Plasmid
PVT16365 2 µg

pCMV-SPORT6-LYG1 Plasmid

Sign In for Pricing
View Details
Toluidine Blue O for cell culture, 90%, Endotoxin (BET) 0.05EU/mg
24000-01 10 g

Toluidine Blue O for cell culture, 90%, Endotoxin (BET) 0.05EU/mg

Sign In for Pricing
View Details
Toluidine Blue O for cell culture, 90%, Endotoxin (BET) 0.05EU/mg
24000-02 25 g

Toluidine Blue O for cell culture, 90%, Endotoxin (BET) 0.05EU/mg

Sign In for Pricing
View Details