Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMO1, Human (HEK293, His)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VMO1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vmo1-protein-human-hek-293-his.html

Smiles

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Formula

284013 (Gene_ID) Q7Z5L0-1 (Q25-S202) (Accession)

Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC1 (NM_003374) Human Tagged Lenti ORF Clone
RC209949L3 10 µg

VDAC1 (NM_003374) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PPM1B Antibody Picoband®
A05731-1-carrier-free 100 µg/Vial

Anti-PPM1B Antibody Picoband®

Sign In for Pricing
View Details
ZNF454 (m) -PR
sc-155723-PR 10 µM - 20 µL

ZNF454 (m) -PR

Sign In for Pricing
View Details
PLA-PEG-PLA
S01YF-0723-KX11 Each

PLA-PEG-PLA

Sign In for Pricing
View Details
RACK1B Antibody
E40P12034 50 µL

RACK1B Antibody

Sign In for Pricing
View Details
Human FAP Protein, His Tag
MBS188232-01 0.01 mg

Human FAP Protein, His Tag

Sign In for Pricing
View Details