Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMO1, Human (HEK293, His)

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

VMO1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vmo1-protein-human-hek-293-his.html

Smiles

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Formula

284013 (Gene_ID) Q7Z5L0-1 (Q25-S202) (Accession)

Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor beta 3 (GABRB3) Rabbit Polyclonal Antibody
TA338701 100 µL

GABA A Receptor beta 3 (GABRB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NOG Protein Lysate (Rat) with C-HA Tag
31978036 100 µg

NOG Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Ammoninum-d4 Deuteroxide
TRC-A634022-10G 10 g

Ammoninum-d4 Deuteroxide

Sign In for Pricing
View Details
Mouse Monoclonal c-Myc Antibody (MYC275 + MYC909) [HRP]
NBP2-47739H 0.1 mL

Mouse Monoclonal c-Myc Antibody (MYC275 + MYC909) [HRP]

Sign In for Pricing
View Details
CD162 Rabbit Polyclonal Antibody (Cy5.5)
orb1050202 100 µL

CD162 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
DYSFIP1, NT (PPP1R27, DYSFIP1, Protein phosphatase 1 regulatory subunit 27, Dysferlin-interacting protein 1, Toonin) (FITC)
MBS6294041-01 0.2 mL

DYSFIP1, NT (PPP1R27, DYSFIP1, Protein phosphatase 1 regulatory subunit 27, Dysferlin-interacting protein 1, Toonin) (FITC)

Sign In for Pricing
View Details