Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD6 Rabbit Polyclonal Antibody (FITC)

CHCHD6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CHCM1, Mic25, MICOS25, PPP1R23

UniProt

Q9BRQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115719

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALT Knockout Raji Polyclonal Cells
ARG910 1 Million

GALT Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Apolipoprotein A-I (Apo A-I) (HRP) discontinued
A2299-28-HRP 100 µL

Apolipoprotein A-I (Apo A-I) (HRP) discontinued

Sign In for Pricing
View Details
Anti Mouse CD11a Flow Cytometry Monoclonal Clone FD4418 PE/Cyanine5 Ready To Use 100 Tests
IRTAMSCD11AFD4418CPECY5100 100 Tests

Anti Mouse CD11a Flow Cytometry Monoclonal Clone FD4418 PE/Cyanine5 Ready To Use 100 Tests

Sign In for Pricing
View Details
C1orf138 Protein Vector (Human) (pPM-C-His)
PV066128 500 ng

C1orf138 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CID1067700, Rab7 GTPase inhibitor
TBI5401-25MG 25 mg

CID1067700, Rab7 GTPase inhibitor

Sign In for Pricing
View Details
Recombinant Human OCM Protein, N-His
YHC56401 100 μg

Recombinant Human OCM Protein, N-His

Sign In for Pricing
View Details