Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD6 Rabbit Polyclonal Antibody (HRP)

CHCHD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHCM1, Mic25, MICOS25, PPP1R23

UniProt

Q9BRQ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115719

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Matrix metalloproteinase-16, Mmp16 ELISA KIT
ELI-05449m 96 Tests

Mouse Matrix metalloproteinase-16, Mmp16 ELISA KIT

Sign In for Pricing
View Details
STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (Biotin) discontinued
S7973-68-Biotin 200 µL

STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (Biotin) discontinued

Sign In for Pricing
View Details
FOXI2 Recombinant Protein (Human)
RP059103 100 µg

FOXI2 Recombinant Protein (Human)

Sign In for Pricing
View Details
CD99L2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0405204 1.0 µg DNA

CD99L2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HEXIM2 Antibody (C-Term)
orb1925833-01 50 µL

HEXIM2 Antibody (C-Term)

Sign In for Pricing
View Details
HEXIM2 Antibody (C-Term)
orb1925833-02 100 µL

HEXIM2 Antibody (C-Term)

Sign In for Pricing
View Details