Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOF1 Rabbit Polyclonal Antibody (Biotin)

ELOF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ELF1

UniProt

P60002

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ELOF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-329 Primers
MPH01434 150 µL - 10 µM

hsa-miR-329 Primers

Sign In for Pricing
View Details
Mouse Monoclonal TRAP alpha Antibody (OTI4C7) [DyLight 488]
NBP2-74591G 0.1 mL

Mouse Monoclonal TRAP alpha Antibody (OTI4C7) [DyLight 488]

Sign In for Pricing
View Details
S100A9 Polyclonal Antibody
A60762 100 µg

S100A9 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human GSPT2 shRNA (UAS) - Lentiviral human GSPT2 shRNA (UAS, RFP) (25)
GTR15298118 1 Vial

Lentiviral human GSPT2 shRNA (UAS) - Lentiviral human GSPT2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (MaxLight 750)
MBS6494830-01 0.1 mL

Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (MaxLight 750)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (MaxLight 750)
MBS6494830-02 5x 0.1 mL

Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) (MaxLight 750)

Sign In for Pricing
View Details