Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM161A Rabbit Polyclonal Antibody (HRP)

FAM161A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP28

UniProt

Q3B820

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
TA380307 100 µL

Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-UNEL-M0125-01 5x 96 Tests

Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit
E-UNEL-M0125-02 15x 96 Tests

Uncoated Mouse RANκL (Receptor Activator of Nuclear Factor Kappa B Ligand) ELISA Kit

Sign In for Pricing
View Details
AGBL4 Human Gene Knockout Kit (CRISPR)
KN416430 1 Kit

AGBL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEIS2 (NM_170676) Human Recombinant Protein
TP308386L 1 mg

MEIS2 (NM_170676) Human Recombinant Protein

Sign In for Pricing
View Details
Arsenic Oxide (As2O5) Hydrate
TRC-A774140-5G 5 g

Arsenic Oxide (As2O5) Hydrate

Sign In for Pricing
View Details