Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXW9 Rabbit Polyclonal Antibody (HRP)

FBXW9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fbw9, MEC-15

UniProt

Q5XUX1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FBXW9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115677

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HS12A HSPA12A Antibody
A13632 100 µL

Anti-HS12A HSPA12A Antibody

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)
orb2990241-01 100 µL

Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)
orb2990241-02 500 µL

Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)
orb2990241-03 1 mL

Goat Anti-Human IgG F (ab') 2 Antibody (AcalephFluor633)

Sign In for Pricing
View Details
Human Parkinson Disease Protein 2 (PARK2) Antibody Pair Kit (with Standard)
MBS2104211-01 5x 96 Tests

Human Parkinson Disease Protein 2 (PARK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Parkinson Disease Protein 2 (PARK2) Antibody Pair Kit (with Standard)
MBS2104211-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Parkinson Disease Protein 2 (PARK2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details