Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLYWCH1 Rabbit Polyclonal Antibody (FITC)

FLYWCH1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q4VC44

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLYWCH1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDHALHGCRSRAITQGQRVTVMRGHCHQPDMEGLEARRQQEKAVETLQAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_115672

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenyl phthalate-3,4,5,6-d4
HY-B1966S-01 1 mg

Diphenyl phthalate-3,4,5,6-d4

Sign In for Pricing
View Details
Diphenyl phthalate-3,4,5,6-d4
HY-B1966S-02 5 mg

Diphenyl phthalate-3,4,5,6-d4

Sign In for Pricing
View Details
Diphenyl phthalate-3,4,5,6-d4
HY-B1966S-03 10 mg

Diphenyl phthalate-3,4,5,6-d4

Sign In for Pricing
View Details
NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, Retinoblastoma-associated Protein HEC, HEC, HEC1, TID3, KNTC2, HsHec1, hsNDC80) (MaxLight 490)
MBS6428427-01 0.1 mL

NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, Retinoblastoma-associated Protein HEC, HEC, HEC1, TID3, KNTC2, HsHec1, hsNDC80) (MaxLight 490)

Sign In for Pricing
View Details
NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, Retinoblastoma-associated Protein HEC, HEC, HEC1, TID3, KNTC2, HsHec1, hsNDC80) (MaxLight 490)
MBS6428427-02 5x 0.1 mL

NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, Retinoblastoma-associated Protein HEC, HEC, HEC1, TID3, KNTC2, HsHec1, hsNDC80) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral mouse Rnf148 shRNA (UAS) - Lentiviral mouse Rnf148 shRNA (UAS, RFP) (25)
GTR15135851 1 Vial

Lentiviral mouse Rnf148 shRNA (UAS) - Lentiviral mouse Rnf148 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details