Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fyttd1 Rabbit Polyclonal Antibody (Biotin)

Fyttd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ac1176, RGD1306899

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Fyttd1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001041364

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)
HY086073-01 50 µg

Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)

Sign In for Pricing
View Details
Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)
HY086073-02 100 µg

Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)

Sign In for Pricing
View Details
Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)
HY086073-03 1 mg

Anti-Phospho-Tau (pS396/pS404) Antibody (SAA0294)

Sign In for Pricing
View Details
GAD65 (GAD2, Glutamate Decarboxylase 2, Glutamate Decarboxylase 65 kDa Isoform, Glutamic Acid Decarboxylase 65)
052466 100 µg

GAD65 (GAD2, Glutamate Decarboxylase 2, Glutamate Decarboxylase 65 kDa Isoform, Glutamic Acid Decarboxylase 65)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii V-type ATP synthase subunit C (atpC)
MBS1408122-01 0.05 mg (E-Coli)

Recombinant Haloferax volcanii V-type ATP synthase subunit C (atpC)

Sign In for Pricing
View Details
Recombinant Haloferax volcanii V-type ATP synthase subunit C (atpC)
MBS1408122-02 0.05 mg (Yeast)

Recombinant Haloferax volcanii V-type ATP synthase subunit C (atpC)

Sign In for Pricing
View Details