Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fyttd1 Rabbit Polyclonal Antibody (HRP)

Fyttd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ac1176, RGD1306899

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Fyttd1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TEQLIDDVVAKRTRQTQKPRLTRTAVPSFLTKREQSDVKKIPKGVPLQFD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001041364

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY1 Polyclonal Antibody
E-AB-16138-01 20 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY1 Polyclonal Antibody
E-AB-16138-02 60 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY1 Polyclonal Antibody
E-AB-16138-03 120 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details
ADCY1 Polyclonal Antibody
E-AB-16138-04 200 µL

ADCY1 Polyclonal Antibody

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL
BNCB1670-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), 0.2mg/mL
BNUB0600-100 1x 100 µL

CD2 (LFA2/600), 0.2mg/mL

Sign In for Pricing
View Details