Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1A Rabbit Polyclonal Antibody (HRP)

MON1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAND1

UniProt

Q86VX9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MON1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001135973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO2, NT (LMO2, RBTN2, RBTNL1, RHOM2, TTG2, Rhombotin-2, Cysteine-rich protein TTG-2, LIM domain only protein 2, T-cell translocation protein 2) (AP) discontinued
037835-AP 200 µL

LMO2, NT (LMO2, RBTN2, RBTNL1, RHOM2, TTG2, Rhombotin-2, Cysteine-rich protein TTG-2, LIM domain only protein 2, T-cell translocation protein 2) (AP) discontinued

Sign In for Pricing
View Details
Leibovitz's L-15, GlutaPlus, Powder
G4570P-10L 10 L

Leibovitz's L-15, GlutaPlus, Powder

Sign In for Pricing
View Details
Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit
MBS7618979-01 48 Well

Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit
MBS7618979-02 96 Well

Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit
MBS7618979-03 5x 96 Well

Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit
MBS7618979-04 10x 96 Well

Human ERG (Transcriptional regulator ERG) QuickTest ELISA Kit

Sign In for Pricing
View Details