Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON1A Rabbit Polyclonal Antibody (FITC)

MON1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SAND1

UniProt

Q86VX9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPPWVRQRAVTGTFCASWTPLRNRRAQRMATDMQRKRSSECLDGTLTPSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001135973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD123/IL3RA Human Monoclonal Antibody
orb2976867-01 100 µg

CD123/IL3RA Human Monoclonal Antibody

Sign In for Pricing
View Details
CD123/IL3RA Human Monoclonal Antibody
orb2976867-02 1 mg

CD123/IL3RA Human Monoclonal Antibody

Sign In for Pricing
View Details
IMMT, CT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52) (PE)
MBS6488300-01 0.2 mL

IMMT, CT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52) (PE)

Sign In for Pricing
View Details
IMMT, CT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52) (PE)
MBS6488300-02 5x 0.2 mL

IMMT, CT (Mitochondrial Inner Membrane Protein, Mitofilin, p87/89, Cell Proliferation-inducing Gene 4 Protein, HMP, PIG4, PIG52) (PE)

Sign In for Pricing
View Details
GRIA2 Antibody Blocking Peptide
orb1509642-01 500 µg

GRIA2 Antibody Blocking Peptide

Sign In for Pricing
View Details
GRIA2 Antibody Blocking Peptide
orb1509642-02 1 mg

GRIA2 Antibody Blocking Peptide

Sign In for Pricing
View Details