Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL45 Rabbit Polyclonal Antibody (FITC)

MRPL45 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L45mt, MRP-L45

UniProt

Q9BRJ2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL45

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Retinol Binding Protein 1, Cellular (RBP1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026135 96 Tests

Multiplex Assay Kit for Retinol Binding Protein 1, Cellular (RBP1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF594 conjugate, 0.1mg/mL
BNC942958-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2958), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CBWD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0370205 3x 1.0 µg

CBWD5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)
MBS7038924-01 0.02 mg

Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)
MBS7038924-02 0.1 mg

Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)
MBS7038924-03 5x 0.1 mg

Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)

Sign In for Pricing
View Details