Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NICN1 Rabbit Polyclonal Antibody (Biotin)

NICN1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC12936

UniProt

Q9BSH3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115692

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Fusobacterium nucleatum subsp.nucleatum Protease HtpX homolog (htpX), partial
MBS7094868 Inquire

Recombinant Fusobacterium nucleatum subsp.nucleatum Protease HtpX homolog (htpX), partial

Sign In for Pricing
View Details
Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit
MBS9926411-01 48 Well

Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit
MBS9926411-02 96 Well

Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit
MBS9926411-03 5x 96 Well

Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit
MBS9926411-04 10x 96 Well

Bovine Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 7 (ENPP7) ELISA Kit

Sign In for Pricing
View Details
Phospho-DDX3 (Thr322) Polyclonal Antibody, Cy5.5 Conjugated
bs-12190R-Cy5.5 100 µL

Phospho-DDX3 (Thr322) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details