Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRC5 Rabbit Polyclonal Antibody (HRP)

NLRC5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NOD4, NOD27, CLR16.1

UniProt

Q86WI3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRC5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

149kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP3 Antibody - N-terminal region
ARP33337_P050-25UL 25 µL

SP3 Antibody - N-terminal region

Sign In for Pricing
View Details
INPP5E Recombinant Protein (Mouse)
RP143906 100 µg

INPP5E Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal USP38 Antibody [DyLight 755]
NB100-40833IR 0.1 mL

Rabbit Polyclonal USP38 Antibody [DyLight 755]

Sign In for Pricing
View Details
Recombinant Human TNNT2 Protein, His (Fc)-Avi-tagged
TNNT2-2229H 50 µg

Recombinant Human TNNT2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
26kD Secreted Antigen, Recombinant, Toxocara canis, aa22-262, His-Tag (Toxocara Excretory-secretory Antigen 26, TES-26)
372090-01 20 µg

26kD Secreted Antigen, Recombinant, Toxocara canis, aa22-262, His-Tag (Toxocara Excretory-secretory Antigen 26, TES-26)

Sign In for Pricing
View Details
26kD Secreted Antigen, Recombinant, Toxocara canis, aa22-262, His-Tag (Toxocara Excretory-secretory Antigen 26, TES-26)
372090-02 100 µg

26kD Secreted Antigen, Recombinant, Toxocara canis, aa22-262, His-Tag (Toxocara Excretory-secretory Antigen 26, TES-26)

Sign In for Pricing
View Details