Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCBD2 Rabbit Polyclonal Antibody (HRP)

PCBD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHS2, DCOH2, DCOHM

UniProt

Q9H0N5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PCBD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_115527

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab9 Antibody [C1J10]
C21092-50uL 50 μL

Rab9 Antibody [C1J10]

Sign In for Pricing
View Details
Mouse Ciapin1 qPCR Primer Pair
QM50822S 200 Tests

Mouse Ciapin1 qPCR Primer Pair

Sign In for Pricing
View Details
STK16, CT (Serine/Threonine-protein Kinase 16, hPSK, MPSK, MPSK1, Myristoylated And Palmitoylated Serine/Threonine-protein Kinase, PKL12, Protein Kinase PKL12, TGF-beta-stimulated Factor 1, TSF1, TSF-1)
MBS624463-01 0.2 mL

STK16, CT (Serine/Threonine-protein Kinase 16, hPSK, MPSK, MPSK1, Myristoylated And Palmitoylated Serine/Threonine-protein Kinase, PKL12, Protein Kinase PKL12, TGF-beta-stimulated Factor 1, TSF1, TSF-1)

Sign In for Pricing
View Details
STK16, CT (Serine/Threonine-protein Kinase 16, hPSK, MPSK, MPSK1, Myristoylated And Palmitoylated Serine/Threonine-protein Kinase, PKL12, Protein Kinase PKL12, TGF-beta-stimulated Factor 1, TSF1, TSF-1)
MBS624463-02 5x 0.2 mL

STK16, CT (Serine/Threonine-protein Kinase 16, hPSK, MPSK, MPSK1, Myristoylated And Palmitoylated Serine/Threonine-protein Kinase, PKL12, Protein Kinase PKL12, TGF-beta-stimulated Factor 1, TSF1, TSF-1)

Sign In for Pricing
View Details
BHLHA15 Antibody (C-term) Blocking Peptide
MBS9217751-01 0.5 mg

BHLHA15 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
BHLHA15 Antibody (C-term) Blocking Peptide
MBS9217751-02 5x 0.5 mg

BHLHA15 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details