Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMG3 Rabbit Polyclonal Antibody (FITC)

PSMG3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PAC3, C7orf48

UniProt

Q9BT73

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_115678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhot1 (NM_001107026) Rat Untagged Clone
RN211224 10 µg

Rhot1 (NM_001107026) Rat Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal Adenylosuccinate Lyase Antibody (05) [Janelia Fluor 669]
NBP3-26085JF669 0.1 mL

Mouse Monoclonal Adenylosuccinate Lyase Antibody (05) [Janelia Fluor 669]

Sign In for Pricing
View Details
SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (AP) discontinued
042319-AP 200 µL

SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (AP) discontinued

Sign In for Pricing
View Details
PPP2R2D Antibody, HRP conjugated
CSB-PA727750LB01HU-01 50 µg

PPP2R2D Antibody, HRP conjugated

Sign In for Pricing
View Details
PPP2R2D Antibody, HRP conjugated
CSB-PA727750LB01HU-02 100 µg

PPP2R2D Antibody, HRP conjugated

Sign In for Pricing
View Details
FAM170A Mouse Monoclonal Antibody [Clone ID: OTI6E4]
TA809624 100 µL

FAM170A Mouse Monoclonal Antibody [Clone ID: OTI6E4]

Sign In for Pricing
View Details