Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QRFPR Rabbit Polyclonal Antibody (HRP)

QRFPR Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AQ27, GPR103, SP9155

UniProt

Q96P65

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human QRFPR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_937822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 9 (FGF9) BioAssayTM ELISA Kit (Porcine) discontinued
025089-01 48 Tests

Fibroblast Growth Factor 9 (FGF9) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
Fibroblast Growth Factor 9 (FGF9) BioAssayTM ELISA Kit (Porcine) discontinued
025089-02 96 Tests

Fibroblast Growth Factor 9 (FGF9) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
Myg1 Recombinant Protein (Rat)
RP212918 100 µg

Myg1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
UBL3 Protein Lysate
OCOA11799-20UG 20 µg

UBL3 Protein Lysate

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c oxidase subunit 7B, mitochondrial (COX7B) , partial
MBS962874-01 1 mg (E-Coli)

Recombinant Bovine Cytochrome c oxidase subunit 7B, mitochondrial (COX7B) , partial

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c oxidase subunit 7B, mitochondrial (COX7B) , partial
MBS962874-02 1 mg (Yeast)

Recombinant Bovine Cytochrome c oxidase subunit 7B, mitochondrial (COX7B) , partial

Sign In for Pricing
View Details