Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Rabbit Polyclonal Antibody (Biotin)

RAB6C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB6C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115520

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1
orb2920589-01 20 µg

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1
orb2920589-02 100 µg

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit E1

Sign In for Pricing
View Details
Lentiviral human DPY30 shRNA (UAS) - Lentiviral human DPY30 shRNA (UAS) (100)
GTR15307269 1 Vial

Lentiviral human DPY30 shRNA (UAS) - Lentiviral human DPY30 shRNA (UAS) (100)

Sign In for Pricing
View Details
MCAM, CT (MCAM, MUC18, Cell surface glycoprotein MUC18, Cell surface glycoprotein P1H12, Melanoma cell adhesion molecule, Melanoma-associated antigen A32, Melanoma-associated antigen MUC18, S-endo 1 endothelial-associated antigen, CD146) (MaxLight 650)
MBS6319515-01 0.1 mL

MCAM, CT (MCAM, MUC18, Cell surface glycoprotein MUC18, Cell surface glycoprotein P1H12, Melanoma cell adhesion molecule, Melanoma-associated antigen A32, Melanoma-associated antigen MUC18, S-endo 1 endothelial-associated antigen, CD146) (MaxLight 650)

Sign In for Pricing
View Details
MCAM, CT (MCAM, MUC18, Cell surface glycoprotein MUC18, Cell surface glycoprotein P1H12, Melanoma cell adhesion molecule, Melanoma-associated antigen A32, Melanoma-associated antigen MUC18, S-endo 1 endothelial-associated antigen, CD146) (MaxLight 650)
MBS6319515-02 5x 0.1 mL

MCAM, CT (MCAM, MUC18, Cell surface glycoprotein MUC18, Cell surface glycoprotein P1H12, Melanoma cell adhesion molecule, Melanoma-associated antigen A32, Melanoma-associated antigen MUC18, S-endo 1 endothelial-associated antigen, CD146) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Uts2r shRNA (UAS) - Lentiviral mouse Uts2r shRNA (UAS) (25)
GTR15177965 1 Vial

Lentiviral mouse Uts2r shRNA (UAS) - Lentiviral mouse Uts2r shRNA (UAS) (25)

Sign In for Pricing
View Details