Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6C Rabbit Polyclonal Antibody (HRP)

RAB6C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WTH3

UniProt

Q9H0N0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB6C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115520

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NDUFA3 Pre-designed siRNA Set A
SI010367A 1 Each

Human NDUFA3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lauryl Sulfate Broth (Lauryl Tryptose Broth – LTB) ISO
1310 500 g

Lauryl Sulfate Broth (Lauryl Tryptose Broth – LTB) ISO

Sign In for Pricing
View Details
Mps1 (TTK) Mouse Monoclonal Antibody [Clone 1D4]
E45M20474V-2 50 µL

Mps1 (TTK) Mouse Monoclonal Antibody [Clone 1D4]

Sign In for Pricing
View Details
Human IgG4 Fc Antibody : Biotin
OASB02558-500UG 0.5 mg

Human IgG4 Fc Antibody : Biotin

Sign In for Pricing
View Details
Rat Endothelin Receptor B (ETRB) ELISA Kit
RDR-ETRB-Ra-48Tests 48 Tests

Rat Endothelin Receptor B (ETRB) ELISA Kit

Sign In for Pricing
View Details
XYLB, NT (XYLB, Xylulose kinase) (Azide free) (HRP)
MBS6364142-01 0.2 mL

XYLB, NT (XYLB, Xylulose kinase) (Azide free) (HRP)

Sign In for Pricing
View Details