Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA2 Rabbit Polyclonal Antibody (HRP)

SLA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MARS, SLAP2, SLAP-2, C20orf156

UniProt

Q9H6Q3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Atf1 Pre-designed siRNA Set B
SI201070B 1 Each

Rat Atf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TGM5 siRNA (Mouse)
CRM9155-01 15 nmol

TGM5 siRNA (Mouse)

Sign In for Pricing
View Details
TGM5 siRNA (Mouse)
CRM9155-02 30 nmol

TGM5 siRNA (Mouse)

Sign In for Pricing
View Details
Human LRRC14B Protein Lysate
MBS8427606-01 0.02 mg

Human LRRC14B Protein Lysate

Sign In for Pricing
View Details
Human LRRC14B Protein Lysate
MBS8427606-02 5x 0.02 mg

Human LRRC14B Protein Lysate

Sign In for Pricing
View Details
Recombinant Bacillus halodurans Tryptophan synthase alpha chain (trpA)
MBS1343721-01 0.02 mg (E-Coli)

Recombinant Bacillus halodurans Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details