Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLA2 Rabbit Polyclonal Antibody (Biotin)

SLA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MARS, SLAP2, SLAP-2, C20orf156

UniProt

Q9H6Q3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_115590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GRO alpha/CXCL1 Antibody Picoband®, HRP Conjugate
PA1760-HRP 100 µg/Vial

Anti-GRO alpha/CXCL1 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Gpr81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3904708 1.0 µg DNA

Gpr81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HIV 1 p24 (1D1)  monoclonal antibody
MB3128 50ul

HIV 1 p24 (1D1) monoclonal antibody

Sign In for Pricing
View Details
ANGPTL1 Rabbit Polyclonal Antibody
orb77076 100 µg

ANGPTL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARL6IP1 (ARL6IP, KIAA0069, ADP-ribosylation Factor-like Protein 6-interacting Protein 1) (MaxLight 750) discontinued
123535-ML750 100 µL

ARL6IP1 (ARL6IP, KIAA0069, ADP-ribosylation Factor-like Protein 6-interacting Protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PCDHGA11 (NM_018914) Human Tagged ORF Clone Lentiviral Particle
RC217347L4V 200 µL

PCDHGA11 (NM_018914) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details