Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A33 Rabbit Polyclonal Antibody (HRP)

SLC25A33 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PNC1, BMSC-MCP

UniProt

Q9BSK2

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIR

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

NCBI Accession Number

NP_115691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), 0.2mg/mL
BNUB0701-100 1x 100 µL

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), 0.2mg/mL

Sign In for Pricing
View Details
Human CXXC11 (RTP5) activation kit by CRISPRa
GA117191 1 Kit

Human CXXC11 (RTP5) activation kit by CRISPRa

Sign In for Pricing
View Details
EGFR (Ab-693) Antibody
8B0009-AAT 50 µg

EGFR (Ab-693) Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details
Pure Vicia faba Lectin (Fava Bean) -VFA-
L-4801-1 1 mg

Pure Vicia faba Lectin (Fava Bean) -VFA-

Sign In for Pricing
View Details