Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcun1d4 Rabbit Polyclonal Antibody (HRP)

Dcun1d4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DCNL4, AI836376

UniProt

Q8CCA0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_849227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vav3 (vav 3 oncogene, Oncogene VAV23 Guanine nucleotide exchange factor, Gef, GDP/GTP Exchange Factor, Gef) (MaxLight 550) discontinued
V2121-15C-ML550 100 µL

Vav3 (vav 3 oncogene, Oncogene VAV23 Guanine nucleotide exchange factor, Gef, GDP/GTP Exchange Factor, Gef) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-01 48 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-02 96 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-03 5x 96 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-04 10x 96 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details
ZFY2 Rabbit pAb, BF700 conjugated
orb2826575 100 µL

ZFY2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details