Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP23 Rabbit Polyclonal Antibody (HRP)

UTP23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C8orf53

UniProt

Q9BRU9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UTP23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim6 AAV siRNA Pooled Vector
47807166 1.0 µg

Trim6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CCDC19, NT (CCDC19, NESG1, Coiled-coil domain-containing protein 19, mitochondrial, Nasopharyngeal epithelium-specific protein 1) (FITC) discontinued
033312-FITC 200 µL

CCDC19, NT (CCDC19, NESG1, Coiled-coil domain-containing protein 19, mitochondrial, Nasopharyngeal epithelium-specific protein 1) (FITC) discontinued

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
MBS3801067-01 48 Well

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
MBS3801067-02 96 Well

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
MBS3801067-03 5x 96 Well

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A2 (ANXA2) ELISA Kit
MBS3801067-04 10x 96 Well

Human Annexin A2 (ANXA2) ELISA Kit

Sign In for Pricing
View Details