Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR54 Rabbit Polyclonal Antibody (HRP)

WDR54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ12953

UniProt

Q9H977

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGPEF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_115494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)
TRV-0058279-01 20 µL

Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)

Sign In for Pricing
View Details
Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)
TRV-0058279-02 100 µL

Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)

Sign In for Pricing
View Details
Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)
TRV-0058279-03 200 µL

Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)

Sign In for Pricing
View Details
Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)
TRV-0058279-04 1 mL

Polyclonal Antibody to Sphingosine 1 Phosphate Receptor 3 (S1PR3)

Sign In for Pricing
View Details
HRH4/GPCR105 Polyclonal Antibody, APC-Cy7 Conjugated
bs-10165R-APC-Cy7 100 µL

HRH4/GPCR105 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Canine Interleukin 2 (IL2) ELISA Kit
RDR-IL2-c-48Tests 48 Tests

Canine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details