Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC9 Rabbit Polyclonal Antibody (HRP)

ZCCHC9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PPP1R41

UniProt

Q8N567

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZCCHC9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115656

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Phenylethylamine Hydroiodide
TRC-P399303-50MG 50 mg

2-Phenylethylamine Hydroiodide

Sign In for Pricing
View Details
Rat Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit
RDR-HSP90aB1-Ra-01 96 Tests

Rat Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit

Sign In for Pricing
View Details
Rat Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit
RDR-HSP90aB1-Ra-02 48 Tests

Rat Heat Shock Protein 90kDa Alpha B1 (HSP90aB1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Blocks, Metastasis, unknown source
CB629905 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
Automated Sample Processing System BLIH-601
BLIH-601 1 Unit

Automated Sample Processing System BLIH-601

Sign In for Pricing
View Details
MIR6791 Human qPCR Primer Pair (MI0022636)
HP301392 200 Reactions

MIR6791 Human qPCR Primer Pair (MI0022636)

Sign In for Pricing
View Details