Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HASPIN Rabbit Polyclonal Antibody (HRP)

HASPIN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GSG2

UniProt

Q8TF76

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQEEATGGAKDTRMVHQTRASLRSVLFGLMNSGTPEDSEFRADGKNMRES

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_114171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Iqgap2 shRNA (UAS) - Lentiviral mouse Iqgap2 shRNA (UAS, RFP) plasmid
GTR15192193 1 Vial

Lentiviral mouse Iqgap2 shRNA (UAS) - Lentiviral mouse Iqgap2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TEF (Thyrotroph Embryonic Factor) Porcine ELISA Kit
H4993 96 Tests

TEF (Thyrotroph Embryonic Factor) Porcine ELISA Kit

Sign In for Pricing
View Details
Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)
MBS1044394-01 0.05 mg (E-Coli)

Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)

Sign In for Pricing
View Details
Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)
MBS1044394-02 0.2 mg (E-Coli)

Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)

Sign In for Pricing
View Details
Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)
MBS1044394-03 0.05 mg (Yeast)

Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)

Sign In for Pricing
View Details
Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)
MBS1044394-04 0.5 mg (E-Coli)

Recombinant Homo sapiens neanderthalensis Osteocalcin (BGLAP)

Sign In for Pricing
View Details