Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK40 Rabbit Polyclonal Antibody (FITC)

STK40 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SHIK, SgK495

UniProt

Q8N2I9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK40

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin monoclonal antibody (ASV30)
ENZ-ABS747-0200 200 µg

Synaptotagmin monoclonal antibody (ASV30)

Sign In for Pricing
View Details
CART (CARTPT) Human shRNA Plasmid Kit (Locus ID 9607)
TL319899 1 Kit

CART (CARTPT) Human shRNA Plasmid Kit (Locus ID 9607)

Sign In for Pricing
View Details
Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag
051125-01 10 µg

Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details
Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag
051125-02 50 µg

Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details
Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag
051125-03 100 µg

Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details
Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag
051125-04 200 µg

Ubiquitin Like Modifier Activating Enzyme 6 (UBA6), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details