Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK40 Rabbit Polyclonal Antibody (HRP)

STK40 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SHIK, SgK495

UniProt

Q8N2I9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK40

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GlyA Antibody
orb815892 2 mg

GlyA Antibody

Sign In for Pricing
View Details
CABP1 Protein Vector (Rat) (pPB-C-His)
PV256994 500 ng

CABP1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
TSPAN18 Recombinant Protein (Rat)
RP235007 100 µg

TSPAN18 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Megf11 shRNA (UAS) - Lentiviral mouse Megf11 shRNA (UAS, GFP) plasmid
GTR15300097 1 Vial

Lentiviral mouse Megf11 shRNA (UAS) - Lentiviral mouse Megf11 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cortisol (Biotin)
MBS6470325-01 0.1 mL

Cortisol (Biotin)

Sign In for Pricing
View Details
Cortisol (Biotin)
MBS6470325-02 5x 0.1 mL

Cortisol (Biotin)

Sign In for Pricing
View Details