Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-27A (RAB27A)

Product Specifications

Product Name Alternative

Rab-27; GTP-binding protein Ram

Abbreviation

Recombinant Human RAB27A protein

Gene Name

RAB27A

UniProt

P51159

Expression Region

2-221aa

Organism

Homo sapiens (Human)

Target Sequence

SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ProBNP Polyclonal Antibody, APC-Cy7 Conjugated
bs-5145R-APC-Cy7 100 µL

ProBNP Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
RPAP3 (NM_024604) Human Tagged ORF Clone Lentiviral Particle
RC223187L3V 200 µL

RPAP3 (NM_024604) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human DEFB1 Protein (Sumo Tag)
PDEH100507-01 20 µg

Recombinant Human DEFB1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human DEFB1 Protein (Sumo Tag)
PDEH100507-02 100 µg

Recombinant Human DEFB1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human DEFB1 Protein (Sumo Tag)
PDEH100507-03 500 µg

Recombinant Human DEFB1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human DEFB1 Protein (Sumo Tag)
PDEH100507-04 1 mg

Recombinant Human DEFB1 Protein (Sumo Tag)

Sign In for Pricing
View Details