Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D10A Rabbit Polyclonal Antibody (HRP)

TBC1D10A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EPI64, TBC1D10, dJ130H16.1, dJ130H16.2

UniProt

Q9BXI6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TBC1D10A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_114143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF5 CRISPR Activation Plasmid (h2)
sc-402133-ACT-2 20 µg

eIF5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
YEATS2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2653904 1.0 µg DNA

YEATS2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Jun D (Jun D Proto-oncogene, JunD, AP-1, Transcription Factor Jun-D) (Azide free) (HRP) discontinued
J7999-02-HRP 200 µL

Jun D (Jun D Proto-oncogene, JunD, AP-1, Transcription Factor Jun-D) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Gstt4 Mouse Gene Knockout Kit (CRISPR)
KN507408 1 Kit

Gstt4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Olfactory receptor 10J4, OR10J4 ELISA KIT
ELI-22580h 96 Tests

Human Olfactory receptor 10J4, OR10J4 ELISA KIT

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) (NM_001128829) Human Recombinant Protein
TP720088M 50 µg

Carbonic Anhydrase I (CA1) (NM_001128829) Human Recombinant Protein

Sign In for Pricing
View Details