Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bco2 Rabbit Polyclonal Antibody (HRP)

Bco2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CMO, Bcdo, Bcmo, CMO2, B-dio, Bcdo2, Bcmo2, B-diox-II

UniProt

Q99NF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFGMTKNYIIF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_573480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Glutamate Decarboxylase 2 (GAD2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027813 96 Tests

Multiplex Assay Kit for Glutamate Decarboxylase 2 (GAD2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
PDLIM3 Antibody
22-144 100 µL

PDLIM3 Antibody

Sign In for Pricing
View Details
C1orf146 (NM_001012425) Human Over-expression Lysate
LH03993V 100 µg

C1orf146 (NM_001012425) Human Over-expression Lysate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060759-01 0.1 mL

APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060759-02 0.2 mL

APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
MBS2060759-03 0.5 mL

APC-Linked Polyclonal Antibody to Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details