Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRO Rabbit Polyclonal Antibody (HRP)

MRO Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B29, C18orf3

UniProt

E9PAT5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MRO

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001120648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lbr shRNA (UAS) - Lentiviral mouse Lbr shRNA (UAS, GFP) plasmid
GTR15258070 1 Vial

Lentiviral mouse Lbr shRNA (UAS) - Lentiviral mouse Lbr shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ZFYVE27 Peptide
orb2016084 100 µg

ZFYVE27 Peptide

Sign In for Pricing
View Details
ZM 306416
A8684-50 50 mg

ZM 306416

Sign In for Pricing
View Details
Spink2 Rat shRNA Lentiviral Particle (Locus ID 408234)
TL701145V 500 µL Each

Spink2 Rat shRNA Lentiviral Particle (Locus ID 408234)

Sign In for Pricing
View Details
VEGFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV699049 1.0 µg DNA

VEGFA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PPP1R3C Peptide - N-terminal region (AAP62902)
AAP62902-100UG 100 µg

PPP1R3C Peptide - N-terminal region (AAP62902)

Sign In for Pricing
View Details