Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM2D2 Rabbit Polyclonal Antibody (HRP)

TM2D2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BLP1

UniProt

Q9BX73

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TM2D2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_510882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKAPL antibody
70R-4022 100 µL

NKAPL antibody

Sign In for Pricing
View Details
ZNF649 Antibody - N-terminal region
OAAB12491-400UL 400 µL

ZNF649 Antibody - N-terminal region

Sign In for Pricing
View Details
Hal sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4826004 1.0 µg DNA

Hal sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Hal qPCR Primer Pair
QM14502S 200 Tests

Mouse Hal qPCR Primer Pair

Sign In for Pricing
View Details
Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (APC)
MBS6453952-01 0.2 mL

Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (APC)

Sign In for Pricing
View Details
Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (APC)
MBS6453952-02 5x 0.2 mL

Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (APC)

Sign In for Pricing
View Details