Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCM2 Rabbit Polyclonal Antibody (FITC)

CCM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OSM, C7orf22, PP10187

UniProt

Q9BSQ5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFHTGYSMENEPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Amyloid (1-42) Mouse Monoclonal Antibody
orb155836-01 50 μL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody
orb155836-02 100 µL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody
orb155836-03 200 µL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody
orb155836-04 200 µg

Beta-Amyloid (1-42) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ZSCAN1, CT (ZSCAN1, Zinc finger and SCAN domain-containing protein 1) (MaxLight 490) discontinued
044411-ML490 100 µL

ZSCAN1, CT (ZSCAN1, Zinc finger and SCAN domain-containing protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Icotinib (BPI-2009H)
C08970-01 5 mg

Icotinib (BPI-2009H)

Sign In for Pricing
View Details