Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCM2 Rabbit Polyclonal Antibody (HRP)

CCM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OSM, C7orf22, PP10187

UniProt

Q9BSQ5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFHTGYSMENEPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit
abx197468-01 96 Tests

Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit

Sign In for Pricing
View Details
Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit
abx197468-02 5x 96 Tests

Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit

Sign In for Pricing
View Details
Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit
abx197468-03 10x 96 Tests

Human Phospholipid Scramblase 1 (PLSCR1) CLIA Kit

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)
MBS7010490-01 0.02 mg

Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)
MBS7010490-02 0.1 mg

Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)
MBS7010490-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9)

Sign In for Pricing
View Details