Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR4 Rabbit Polyclonal Antibody (FITC)

CBR4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SDR45C1

UniProt

Q8N4T8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR9 Rabbit pAb, Pacific Blue conjugated
orb2845775 100 µL

TLR9 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)
MBS1011762-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)
MBS1011762-02 0.02 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)
MBS1011762-03 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)
MBS1011762-04 0.1 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)
MBS1011762-05 0.02 mg (Baculovirus)

Recombinant Vibrio cholerae serotype O1 Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details