Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR4 Rabbit Polyclonal Antibody (HRP)

CBR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDR45C1

UniProt

Q8N4T8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116172

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit
MBS9359258-01 48 Well

Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit
MBS9359258-02 96 Well

Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit
MBS9359258-03 5x 96 Well

Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit

Sign In for Pricing
View Details
Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit
MBS9359258-04 10x 96 Well

Rat Integral Membrane Protein GPR155 (GPR155) ELISA Kit

Sign In for Pricing
View Details
BSL2 Antibody
orb838692 2 mg

BSL2 Antibody

Sign In for Pricing
View Details
PM2.5 Membrane PTFE 46.2mm
7592-104 50 / PCK

PM2.5 Membrane PTFE 46.2mm

Sign In for Pricing
View Details