Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zc3h10 Rabbit Polyclonal Antibody (HRP)

Zc3h10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI790326

UniProt

Q8R205

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep250 Mouse qPCR Primer Pair (NM_001130000)
MP222257 200 Reactions

Cep250 Mouse qPCR Primer Pair (NM_001130000)

Sign In for Pricing
View Details
UBE2I antibody
FNab09155 100 µg

UBE2I antibody

Sign In for Pricing
View Details
C1orf76 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-11711R-PE-Cy5.5 100 µL

C1orf76 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Gene Mutation Detection Kit for Moderately to well differentiated adenocarcinoma (E(G719X);K(-) Mutation)
MLER-23 1 Kit

Gene Mutation Detection Kit for Moderately to well differentiated adenocarcinoma (E(G719X);K(-) Mutation)

Sign In for Pricing
View Details
C9orf72 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8595R-BF405 100 µL

C9orf72 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12) (PE) discontinued
033800-PE 200 µL

CF062, ID (C6orf62, XTP12, Uncharacterized protein C6orf62, HBV X-transactivated gene 12 protein, HBV XAg-transactivated protein 12) (PE) discontinued

Sign In for Pricing
View Details