Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC12 Rabbit Polyclonal Antibody (FITC)

ZDHHC12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF400, DHHC-12

UniProt

Q96GR4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZDHHC12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem253 Mouse Gene Knockout Kit (CRISPR)
KN517837 1 Kit

Tmem253 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR10R2 Human Gene Knockout Kit (CRISPR)
KN422264 1 Kit

OR10R2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 (DG1/447), Biotin conjugate, 0.1mg/mL
BNCB0447-100 1x 100 µL

DOG-1 (DG1/447), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802264 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details